PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ONIVA01G42540.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB
Protein Properties Length: 439aa    MW: 47096 Da    PI: 7.4482
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ONIVA01G42540.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.33.1e-17107153148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+WT +Ede l++ v ++G + W+tIa+ ++ gR +kqc++rw ++l
  ONIVA01G42540.1 107 KGAWTRQEDEVLKQMVILHGDRKWATIAKSLP-GRIGKQCRERWTNHL 153
                      79******************************.************996 PP

2Myb_DNA-binding55.11.7e-17159201145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      ++ WT+e+d  l++a+k +G++ W+ Iar+++ gR+++ +k++w+
  ONIVA01G42540.1 159 KDVWTEEDDRMLIEAHKTYGNR-WSVIARCLP-GRSENAVKNHWN 201
                      578*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129426.482102157IPR017930Myb domain
SuperFamilySSF466891.05E-29104200IPR009057Homeodomain-like
SMARTSM007177.8E-16106155IPR001005SANT/Myb domain
PfamPF002492.3E-15107153IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.9E-25108160IPR009057Homeodomain-like
CDDcd001671.44E-14109153No hitNo description
PROSITE profilePS5129418.376158208IPR017930Myb domain
SMARTSM007174.8E-18158206IPR001005SANT/Myb domain
PfamPF002493.9E-15159201IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.3E-21161205IPR009057Homeodomain-like
CDDcd001678.41E-15162204No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 439 aa     Download sequence    Send to blast
MAAAGNSFLN QDPTMMGSGM PHMYFASSSH GTGAHYQSPG GAPITMAVPD MGFLVAGIGM  60
APSSFVMPEG ALAASYSAMA TVPVGVVVPQ QQSSRFGGNN GNPGSFKGAW TRQEDEVLKQ  120
MVILHGDRKW ATIAKSLPGR IGKQCRERWT NHLRPDIKKD VWTEEDDRML IEAHKTYGNR  180
WSVIARCLPG RSENAVKNHW NATKRSLKSK RRMKKKSVQV VNSPPGQLSP LEEYIRSQYP  240
SAVETTPLPP AVPAPPSDVI VHGAGSVSAG PTVATQEPTG TNPSEMGIYL GLGNPAGPTT  300
QQLAAMNLNM SLAPDLNAYN DQREGYYLPF VPQGNLHYGM HVPAPPVQQQ QQQGISVDQG  360
LHSSCLSLYH PFPGTHPVSL DFGCQSSNHA NAGGYYSEAG PSSGSGSGDP DDVDVIQMAS  420
RQFLMPSEAE VTLDLTRFK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-431012091110B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2879950.0AK287995.1 Oryza sativa Japonica Group cDNA, clone: J075101C16, full insert sequence.
GenBankFJ9402150.0FJ940215.1 Oryza sativa Japonica Group clone KCS005D12 Myb protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015645142.10.0PREDICTED: uncharacterized protein LOC4324828
TrEMBLA0A0E0N5540.0A0A0E0N554_ORYRU; Uncharacterized protein
STRINGLOC_Os01g63680.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP188233101
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27785.13e-44myb domain protein 118